(data stored in ACNUC7421 zone)

EMBL: CP000271.PE580

CP000271.PE580       Location/Qualifiers
FT   CDS             complement(684259..684999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2443"
FT                   /product="Putative branched-chain amino acid exporter,
FT                   LIV-E family"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33548"
FT                   /db_xref="GOA:Q13QU1"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QU1"
FT                   /protein_id="ABE33548.1"
FT                   /translation="MTRNKNTLECASGAHERDLAHGGAFLGALNMLPLCLSVLPWGILA
FT                   GSMAVQSGLTLWQSIGMSAIVFAGAAQLVTLGLHMSGASALTIIVSVFLITAQHFLYGL
FT                   NLRGYVSTLRKRHRLPIGFLLTDELFALSSASKIKSQLTPGYLIGAGLAFYLSWNLFSL
FT                   LGIFTAASVPDLSRYHLDFSIVATFAAIVIPMIRKISVLSGVLFSLLTSMLLSYFHVGG
FT                   AIVIAGVSGMFFSSFVARLRKEAP"
     MTRNKNTLEC ASGAHERDLA HGGAFLGALN MLPLCLSVLP WGILAGSMAV QSGLTLWQSI        60
     GMSAIVFAGA AQLVTLGLHM SGASALTIIV SVFLITAQHF LYGLNLRGYV STLRKRHRLP       120
     IGFLLTDELF ALSSASKIKS QLTPGYLIGA GLAFYLSWNL FSLLGIFTAA SVPDLSRYHL       180
     DFSIVATFAA IVIPMIRKIS VLSGVLFSLL TSMLLSYFHV GGAIVIAGVS GMFFSSFVAR       240
     LRKEAP                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page