(data stored in ACNUC7421 zone)

EMBL: CP000271.PE586

CP000271.PE586       Location/Qualifiers
FT   CDS             complement(691332..691739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2437"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2437"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33554"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QT5"
FT                   /protein_id="ABE33554.1"
FT                   /translation="MTIRCRALAACACFALATTLAWADGDAPTAPAPAGGYNYPTQGRV
FT                   EYVLSCMDDNGHDFVNVYKCSCVIDKMATALSYDDFVAQSTFSKYATLGGEGGSEFRVD
FT                   HAKAQTKKFRTLQTQAYHSCGLGPDKTASAK"
     MTIRCRALAA CACFALATTL AWADGDAPTA PAPAGGYNYP TQGRVEYVLS CMDDNGHDFV        60
     NVYKCSCVID KMATALSYDD FVAQSTFSKY ATLGGEGGSE FRVDHAKAQT KKFRTLQTQA       120
     YHSCGLGPDK TASAK                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page