(data stored in SCRATCH zone)

EMBL: CP000271.PE59

CP000271.PE59        Location/Qualifiers
FT   CDS             65686..67287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2968"
FT                   /product="bacterial peptide chain release factor 3 (bRF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2968"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33027"
FT                   /db_xref="GOA:Q13SB2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB2"
FT                   /protein_id="ABE33027.1"
FT                   /translation="MSVSELKRRRTFAVISHPDAGKTTLTEKLLLFSGAIQIAGTVKGR
FT                   KSNRYATSDWMEIEKQRGISVASSVMQFEYGDAVINLLDTPGHEDFSEDTYRVLTAVDA
FT                   AVMVIDGANGVEAQTLKLLEVCRSRKTPIVTFINKLDREVREPLELLDEIEQHLGVAAV
FT                   PFTWPIGMGKDFQGVYDIQRDQVRLFRAGQDKAGGEVETLQALSDEEGERRFGHAWVKA
FT                   KEEIDLITGASPDFDREQFLAGQQSPVLFGSAINNFGVKEILDALVDLAPPPSMRMTVQ
FT                   RPVMPDEPKFTGVVFKVQANMDLAHRDRVAFIRVCSGHFERGMAVKVTRTSKTFRANNV
FT                   VTFLSQRRETVSEAYPGDIIGIPNHGTLSLGDTLTEGEQLQFVGLPFFAPEIFQTVEVV
FT                   DPMRAKQLGEALKQLGEEGAIQVFRPEVGGLMILGAVGQLQFEVVSHRLSTEYKVDVRM
FT                   APARYRMSRWVTCDDAAELRRFTDSYAARIALDASDAPTYLASHVSEIEVAQKAWPKIV
FT                   FNELREHSGAPFKRAM"
     MSVSELKRRR TFAVISHPDA GKTTLTEKLL LFSGAIQIAG TVKGRKSNRY ATSDWMEIEK        60
     QRGISVASSV MQFEYGDAVI NLLDTPGHED FSEDTYRVLT AVDAAVMVID GANGVEAQTL       120
     KLLEVCRSRK TPIVTFINKL DREVREPLEL LDEIEQHLGV AAVPFTWPIG MGKDFQGVYD       180
     IQRDQVRLFR AGQDKAGGEV ETLQALSDEE GERRFGHAWV KAKEEIDLIT GASPDFDREQ       240
     FLAGQQSPVL FGSAINNFGV KEILDALVDL APPPSMRMTV QRPVMPDEPK FTGVVFKVQA       300
     NMDLAHRDRV AFIRVCSGHF ERGMAVKVTR TSKTFRANNV VTFLSQRRET VSEAYPGDII       360
     GIPNHGTLSL GDTLTEGEQL QFVGLPFFAP EIFQTVEVVD PMRAKQLGEA LKQLGEEGAI       420
     QVFRPEVGGL MILGAVGQLQ FEVVSHRLST EYKVDVRMAP ARYRMSRWVT CDDAAELRRF       480
     TDSYAARIAL DASDAPTYLA SHVSEIEVAQ KAWPKIVFNE LREHSGAPFK RAM              533
//

If you have problems or comments...

PBIL Back to PBIL home page