(data stored in ACNUC7421 zone)

EMBL: CP000271.PE596

CP000271.PE596       Location/Qualifiers
FT   CDS             699757..701574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2427"
FT                   /product="Methanol dehydrogenase-like protein (xoxF)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2427"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33564"
FT                   /db_xref="GOA:Q13QS5"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS5"
FT                   /protein_id="ABE33564.1"
FT                   /translation="MNLRTTVLGLAILASAALSSFVAQADSQLDGLMKNPSNWAAQAGD
FT                   YANHRYSPLKQINENNVGKLQVAWTMSTGVLRGHEGAPLVIGDTMYIHSPFPNKVIAIN
FT                   LKDQTFIWQYLPKQDDQVVSVMCCDTVNRGLAYGDGKIFLQQADTKLVALNAKTGDVVW
FT                   TAQNGNPKAGETNTNAPHVFGDKVLTGISGGEFGVRGRLIAYDIKTGKPAWTAYSTGPD
FT                   KDMLIDPDKTTTYADGKMVPVGADSSLKSWKGDQWKLGGGTTWGWYAWDPKLNLVYYGT
FT                   GNPGTWNPTQRPGDNKWSMSIFARDLNTGQARWVYQMTPHDEWDYDGVNEMILSDLSID
FT                   GKKVPAIVHFDRNGFGYTLNRETGQLLVAQKFDPAVNWADHVDMKSGKPIRNAAYSTQA
FT                   AGSDHNVKGICPAALGSKDQQPAAYDPGSSLFLVPTNHVCMDYEPFDVDYVSGQPYVGA
FT                   TLSMYPGPNDNNSMGNFIAWDASKGKIVWSKPERFSVWSGVLATAGGVAFYGTLEGYIK
FT                   AVRIKDGKELWRFKTPSGIIGNVFTYEYQGKQFIGVYSGIGGWAGIGMAAGLEKSTEGL
FT                   GAVGGYRELAKYTALGGTLFVFAIPGGNS"
     MNLRTTVLGL AILASAALSS FVAQADSQLD GLMKNPSNWA AQAGDYANHR YSPLKQINEN        60
     NVGKLQVAWT MSTGVLRGHE GAPLVIGDTM YIHSPFPNKV IAINLKDQTF IWQYLPKQDD       120
     QVVSVMCCDT VNRGLAYGDG KIFLQQADTK LVALNAKTGD VVWTAQNGNP KAGETNTNAP       180
     HVFGDKVLTG ISGGEFGVRG RLIAYDIKTG KPAWTAYSTG PDKDMLIDPD KTTTYADGKM       240
     VPVGADSSLK SWKGDQWKLG GGTTWGWYAW DPKLNLVYYG TGNPGTWNPT QRPGDNKWSM       300
     SIFARDLNTG QARWVYQMTP HDEWDYDGVN EMILSDLSID GKKVPAIVHF DRNGFGYTLN       360
     RETGQLLVAQ KFDPAVNWAD HVDMKSGKPI RNAAYSTQAA GSDHNVKGIC PAALGSKDQQ       420
     PAAYDPGSSL FLVPTNHVCM DYEPFDVDYV SGQPYVGATL SMYPGPNDNN SMGNFIAWDA       480
     SKGKIVWSKP ERFSVWSGVL ATAGGVAFYG TLEGYIKAVR IKDGKELWRF KTPSGIIGNV       540
     FTYEYQGKQF IGVYSGIGGW AGIGMAAGLE KSTEGLGAVG GYRELAKYTA LGGTLFVFAI       600
     PGGNS                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page