(data stored in ACNUC7421 zone)

EMBL: CP000271.PE597

CP000271.PE597       Location/Qualifiers
FT   CDS             701756..702175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2426"
FT                   /product="Putative methanol dehydrogenase-like protein,
FT                   cytochrome cL (xoxG)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2426"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33565"
FT                   /db_xref="GOA:Q13QS4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS4"
FT                   /protein_id="ABE33565.1"
FT                   /translation="MKGRSILLRAALPAVFVVLPAAFAQTNPAIAQVAYKVVDGSKVDP
FT                   NTLQGWKTWRALACERCHGAQQQGMVGPSLVDAFKTLDKTEFHRTVFGGRVDKGMPDFS
FT                   SSQMMQKNWENLYAYLKGRSDGQIKPGDLQAIDSK"
     MKGRSILLRA ALPAVFVVLP AAFAQTNPAI AQVAYKVVDG SKVDPNTLQG WKTWRALACE        60
     RCHGAQQQGM VGPSLVDAFK TLDKTEFHRT VFGGRVDKGM PDFSSSQMMQ KNWENLYAYL       120
     KGRSDGQIKP GDLQAIDSK                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page