(data stored in ACNUC7421 zone)

EMBL: CP000271.PE598

CP000271.PE598       Location/Qualifiers
FT   CDS             702206..703117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2425"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2425"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33566"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR022448"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS3"
FT                   /protein_id="ABE33566.1"
FT                   /translation="MRHGKRMPTHVAIVTAALCYAAIASGAVRAQGEAMPNNDGADGVL
FT                   RVCADPNNMPLSNNKGEGYENRIASQMASDFGYKLEYTYFPQRMGFVRHTLREKVPDTE
FT                   RYKCDLIIGVPKGYDMTSTTQPYLRSTYAMVFTKRPELAGINTPDDLLKLPPDQLHKLR
FT                   FGIFTQTPAVDWLLSHDLIDQAVSYQVQSGDPQEYPGQMIEKDLQAGNVDVVFLWGPIA
FT                   GYFAKRSGDTVKLVPFPATPGIRFDYTISMGVRYGEKAWKDKVDQWIGANHDKIDNILT
FT                   SYEVPLLKPVDTPAGKPADGSP"
     MRHGKRMPTH VAIVTAALCY AAIASGAVRA QGEAMPNNDG ADGVLRVCAD PNNMPLSNNK        60
     GEGYENRIAS QMASDFGYKL EYTYFPQRMG FVRHTLREKV PDTERYKCDL IIGVPKGYDM       120
     TSTTQPYLRS TYAMVFTKRP ELAGINTPDD LLKLPPDQLH KLRFGIFTQT PAVDWLLSHD       180
     LIDQAVSYQV QSGDPQEYPG QMIEKDLQAG NVDVVFLWGP IAGYFAKRSG DTVKLVPFPA       240
     TPGIRFDYTI SMGVRYGEKA WKDKVDQWIG ANHDKIDNIL TSYEVPLLKP VDTPAGKPAD       300
     GSP                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page