(data stored in ACNUC7421 zone)

EMBL: CP000271.PE599

CP000271.PE599       Location/Qualifiers
FT   CDS             703183..703887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2424"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33567"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS2"
FT                   /protein_id="ABE33567.1"
FT                   /translation="MCATHSAAFAAGADEISAAERLIFTTDHLHGIQQQTELDYAFLST
FT                   DQPAHSTDVVKVLVVSPDNAKGDAQVSDHSGAVPLPNAGLQCNPVIIYFLERDIAEMEH
FT                   LTGGQRRYFQQRLRLALAAGPKIETVTSQVGGKPVKARQIVVQPYLGDPNSERFAQYIG
FT                   KRYTFLIADTVPGEVALIRTDVPGANNDFAHPLQTQTLSFQAALRKLPPPPNAPNAPNV
FT                   PLKPSDAPRASR"
     MCATHSAAFA AGADEISAAE RLIFTTDHLH GIQQQTELDY AFLSTDQPAH STDVVKVLVV        60
     SPDNAKGDAQ VSDHSGAVPL PNAGLQCNPV IIYFLERDIA EMEHLTGGQR RYFQQRLRLA       120
     LAAGPKIETV TSQVGGKPVK ARQIVVQPYL GDPNSERFAQ YIGKRYTFLI ADTVPGEVAL       180
     IRTDVPGANN DFAHPLQTQT LSFQAALRKL PPPPNAPNAP NVPLKPSDAP RASR             234
//

If you have problems or comments...

PBIL Back to PBIL home page