(data stored in SCRATCH zone)

EMBL: CP000271.PE6

CP000271.PE6         Location/Qualifiers
FT   CDS             complement(8112..8507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B3023"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B3023"
FT                   /db_xref="EnsemblGenomes-Tr:ABE32974"
FT                   /db_xref="InterPro:IPR018894"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SG5"
FT                   /protein_id="ABE32974.1"
FT                   /translation="MNDLITDSTDHALAALRYQTAARDLERIVRNIAARYIVQEVPLTW
FT                   RLLHAIEAEALADLGFASRHDALMLGLFQRPSGLPYPETDEAVDFGTSTALPAVFAFAV
FT                   SAYEEAARRAAQASQNTALRHARAWGD"
     MNDLITDSTD HALAALRYQT AARDLERIVR NIAARYIVQE VPLTWRLLHA IEAEALADLG        60
     FASRHDALML GLFQRPSGLP YPETDEAVDF GTSTALPAVF AFAVSAYEEA ARRAAQASQN       120
     TALRHARAWG D                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page