(data stored in ACNUC7421 zone)

EMBL: CP000271.PE601

CP000271.PE601       Location/Qualifiers
FT   CDS             704862..705458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2422"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2422"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33569"
FT                   /db_xref="InterPro:IPR021698"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QS0"
FT                   /protein_id="ABE33569.1"
FT                   /translation="MNRAGGEVRGGYVRYGRYVGPIGMICVAFACSQALGAPTSIAVMD
FT                   CVLIDDNAAYNDAGTNRIQQARIGMVSEALREQLRESQRYRVADNAAAAGLIAQLGASQ
FT                   DLNACADCARQVGRKLGVEQIGLCWVQKVSNLILNINLHVEDVGSGATVFQRSVDIRGN
FT                   TDLSWRRGAAALAGLLAGGTAAGSAASSTERGASP"
     MNRAGGEVRG GYVRYGRYVG PIGMICVAFA CSQALGAPTS IAVMDCVLID DNAAYNDAGT        60
     NRIQQARIGM VSEALREQLR ESQRYRVADN AAAAGLIAQL GASQDLNACA DCARQVGRKL       120
     GVEQIGLCWV QKVSNLILNI NLHVEDVGSG ATVFQRSVDI RGNTDLSWRR GAAALAGLLA       180
     GGTAAGSAAS STERGASP                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page