(data stored in ACNUC7421 zone)

EMBL: CP000271.PE602

CP000271.PE602       Location/Qualifiers
FT   CDS             705668..706687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2421"
FT                   /product="Putative MxaR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2421"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33570"
FT                   /db_xref="GOA:Q13QR9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR9"
FT                   /protein_id="ABE33570.1"
FT                   /translation="MGAGELLQDWRVHALRIEDEVSRVVIGQPQTIRLITVALFARGHV
FT                   LLEGGVGVGKTTVLRAFARVVGGEFERVEGTIDLMPGDLVYHTYVDAEGRPRIDPGPLL
FT                   RHGERLTTFFFNEINRARPQVQSLLLRAMAERSVWAFDREYRFPHMTVFADRNKVEKEE
FT                   TFELASAARDRFLFELGMPTPTEPDVRRSLVFDAAFHDVDSLLARLPPAIVQWEQLNQV
FT                   GAAIQESVQSSETIERYVLDIWQATETPQRFGIALDGVDMDRLILAGASPRGMSALLRA
FT                   ARVVAWLAGRSHLVPEDIHAVLMPALGHRVFFTPIYELRRQELAEALMTQIMNRLAVP"
     MGAGELLQDW RVHALRIEDE VSRVVIGQPQ TIRLITVALF ARGHVLLEGG VGVGKTTVLR        60
     AFARVVGGEF ERVEGTIDLM PGDLVYHTYV DAEGRPRIDP GPLLRHGERL TTFFFNEINR       120
     ARPQVQSLLL RAMAERSVWA FDREYRFPHM TVFADRNKVE KEETFELASA ARDRFLFELG       180
     MPTPTEPDVR RSLVFDAAFH DVDSLLARLP PAIVQWEQLN QVGAAIQESV QSSETIERYV       240
     LDIWQATETP QRFGIALDGV DMDRLILAGA SPRGMSALLR AARVVAWLAG RSHLVPEDIH       300
     AVLMPALGHR VFFTPIYELR RQELAEALMT QIMNRLAVP                              339
//

If you have problems or comments...

PBIL Back to PBIL home page