(data stored in ACNUC7421 zone)

EMBL: CP000271.PE603

CP000271.PE603       Location/Qualifiers
FT   CDS             706691..707560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2420"
FT                   /product="Putative MxaS-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2420"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33571"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR8"
FT                   /protein_id="ABE33571.1"
FT                   /translation="MNGTAEFHYRLPMRAGGFRPGSHPGSSFGAGQEFAMHGRLFDYPD
FT                   PRRLDLRASVRAARSEWLVRVHLQRAAVPVQVIVDVSASMHFGKRRTKSQVAADFVEAL
FT                   GYSAFRVGDPLGMLAFDTRARDDLFMPARYGRGVGNLLATMLRESESASDAAGSGGIAG
FT                   LQRAASALAGRQALIFLVSDFHWPLAALPAVLDLLVHACVVPIVVWDAAEIAPPNGGSL
FT                   LAVNDAESARQRTLWLRGSVRERWREAVARRRAELANVFGKRGIQPFYVESAFDPEAMS
FT                   RYFLETIA"
     MNGTAEFHYR LPMRAGGFRP GSHPGSSFGA GQEFAMHGRL FDYPDPRRLD LRASVRAARS        60
     EWLVRVHLQR AAVPVQVIVD VSASMHFGKR RTKSQVAADF VEALGYSAFR VGDPLGMLAF       120
     DTRARDDLFM PARYGRGVGN LLATMLRESE SASDAAGSGG IAGLQRAASA LAGRQALIFL       180
     VSDFHWPLAA LPAVLDLLVH ACVVPIVVWD AAEIAPPNGG SLLAVNDAES ARQRTLWLRG       240
     SVRERWREAV ARRRAELANV FGKRGIQPFY VESAFDPEAM SRYFLETIA                   289
//

If you have problems or comments...

PBIL Back to PBIL home page