(data stored in ACNUC7421 zone)

EMBL: CP000271.PE604

CP000271.PE604       Location/Qualifiers
FT   CDS             707557..708516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2418a"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2418a"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33572"
FT                   /db_xref="GOA:Q13QR7"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR7"
FT                   /protein_id="ABE33572.1"
FT                   /translation="MRPDGRGVGRSGRSLCEASGATRFVSALALTLTLVLALAPAISVA
FT                   AGSGDVLQPTVQEPRAFGHLLGDIVTQRILLRAGDNDVGSVAPPSIGRTGAWLERRPAR
FT                   IETDAEGRRWMAIDYQIVNVAPTLTRIALPALTLTSASGATLQVAEWPLSIGPITSADA
FT                   FEAGDLQRMRPDRQAPLMPTAPLRRQAAFALGLLLLTLLSWAGWWLWRNWRESARLPFA
FT                   RAWRQMRRLDGPNADMSADAWLCLHRALNETAGHVVHAGSLPSLFARAPYLQPLHAQLE
FT                   QFYQQSGERFFTPAPALAPYPLRGLCRALYRAEQRHQR"
     MRPDGRGVGR SGRSLCEASG ATRFVSALAL TLTLVLALAP AISVAAGSGD VLQPTVQEPR        60
     AFGHLLGDIV TQRILLRAGD NDVGSVAPPS IGRTGAWLER RPARIETDAE GRRWMAIDYQ       120
     IVNVAPTLTR IALPALTLTS ASGATLQVAE WPLSIGPITS ADAFEAGDLQ RMRPDRQAPL       180
     MPTAPLRRQA AFALGLLLLT LLSWAGWWLW RNWRESARLP FARAWRQMRR LDGPNADMSA       240
     DAWLCLHRAL NETAGHVVHA GSLPSLFARA PYLQPLHAQL EQFYQQSGER FFTPAPALAP       300
     YPLRGLCRAL YRAEQRHQR                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page