(data stored in ACNUC7421 zone)

EMBL: CP000271.PE607

CP000271.PE607       Location/Qualifiers
FT   CDS             710134..711087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2416"
FT                   /product="Putative MxaL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2416"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33575"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QR4"
FT                   /protein_id="ABE33575.1"
FT                   /translation="MSFREWTRGFSRGRHWATPAALLLLIAAVAMPRVVLPRNTFSYIV
FT                   TFDITQSMDVEDVALNGVPVSRLGFARSAMRDAIGRLPCGSKVGWSVFTGQRTLLLLPP
FT                   VEVCGNYDALLSSLDRIDWHMRWTNWSRIAEGGVYSAVRVAQDVGHGAAVVFVTDGQEA
FT                   PPVLPSDAPTRDINPARVTGWLIGVGGDQAAPIPHTDADGNRNGYWQADDVIQVPPQPG
FT                   SATQAESHEELSALHGHYLAAVAAQIGFGYRRLLGAEALSDAMLDVRFAHREPVPTDLR
FT                   WCPALLALLLLVWRFAPEFRWARGRVTGRSANSSYV"
     MSFREWTRGF SRGRHWATPA ALLLLIAAVA MPRVVLPRNT FSYIVTFDIT QSMDVEDVAL        60
     NGVPVSRLGF ARSAMRDAIG RLPCGSKVGW SVFTGQRTLL LLPPVEVCGN YDALLSSLDR       120
     IDWHMRWTNW SRIAEGGVYS AVRVAQDVGH GAAVVFVTDG QEAPPVLPSD APTRDINPAR       180
     VTGWLIGVGG DQAAPIPHTD ADGNRNGYWQ ADDVIQVPPQ PGSATQAESH EELSALHGHY       240
     LAAVAAQIGF GYRRLLGAEA LSDAMLDVRF AHREPVPTDL RWCPALLALL LLVWRFAPEF       300
     RWARGRVTGR SANSSYV                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page