(data stored in ACNUC7421 zone)

EMBL: CP000271.PE61

CP000271.PE61        Location/Qualifiers
FT   CDS             complement(70176..70721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2966"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2966"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33029"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SB0"
FT                   /protein_id="ABE33029.1"
FT                   /translation="MAKLLTDSEFQRFSELQQKQSSFTITPEEADELRDIVAHAQKRRD
FT                   DRAAAMQSIETFIQQFDISPDELFSAEQIGDAARTFGLIPAAKKERVLPPQFTFNGKPY
FT                   QWTTRPLPDDIRVPLFDAFKAGESVKSFIATPKDANRCAATIARLERETGAVYGDAWLE
FT                   ELSVTRTQVDEAAAKLPA"
     MAKLLTDSEF QRFSELQQKQ SSFTITPEEA DELRDIVAHA QKRRDDRAAA MQSIETFIQQ        60
     FDISPDELFS AEQIGDAART FGLIPAAKKE RVLPPQFTFN GKPYQWTTRP LPDDIRVPLF       120
     DAFKAGESVK SFIATPKDAN RCAATIARLE RETGAVYGDA WLEELSVTRT QVDEAAAKLP       180
     A                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page