(data stored in ACNUC7421 zone)

EMBL: CP000271.PE613

CP000271.PE613       Location/Qualifiers
FT   CDS             716913..718580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2410"
FT                   /product="putative rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2410"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33581"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ8"
FT                   /protein_id="ABE33581.1"
FT                   /translation="MSHSTIPLITPAALRAALADRRELAILDVREEGVSARRRLFYSSI
FT                   AAVGRLGLVVGQLVPRLTTPVVLVDEAGEYASRAAALLASFGYTHVSILEGGVSGWEAA
FT                   GFEVFSGTNVPGKAFGEVIEHRLHTPNIDAPTLRQLQDAGEDLVVLDSRPFPEYQTMNI
FT                   PGGVECAGAELVHRALAAAPSPDTLIVVNCAGRTRSILGAQSLVNAGIPNPVAALTGGS
FT                   MSWLLSGFELERGRISTAPRPDGAALASARTLAQRAAARAGVVEIDRATLARFESEAAT
FT                   HTLYRFDVRAPLEYEAGHRAGWRSAPGGQLVQATDEYVGTLHARVVLADDDGVRARMTA
FT                   SWLVQLGYLQVFVLADDDSSAAFETGPEPLPIFRTRGRTQWIEADQLAQTLEAGSAQVV
FT                   DVDSSLAFRRAHIAGARFVAASALEDLLERIDADASRQLVLTSSDGVLAGLLANQLRER
FT                   REGVAALLGGTQRWLALGLPQASGDEGNLTGDDDAWYSPYHYAPAQAAQQMEAYLAWEL
FT                   QLVGQLERDGIASINVIDFDTPTHRRSEERLAALRRAN"
     MSHSTIPLIT PAALRAALAD RRELAILDVR EEGVSARRRL FYSSIAAVGR LGLVVGQLVP        60
     RLTTPVVLVD EAGEYASRAA ALLASFGYTH VSILEGGVSG WEAAGFEVFS GTNVPGKAFG       120
     EVIEHRLHTP NIDAPTLRQL QDAGEDLVVL DSRPFPEYQT MNIPGGVECA GAELVHRALA       180
     AAPSPDTLIV VNCAGRTRSI LGAQSLVNAG IPNPVAALTG GSMSWLLSGF ELERGRISTA       240
     PRPDGAALAS ARTLAQRAAA RAGVVEIDRA TLARFESEAA THTLYRFDVR APLEYEAGHR       300
     AGWRSAPGGQ LVQATDEYVG TLHARVVLAD DDGVRARMTA SWLVQLGYLQ VFVLADDDSS       360
     AAFETGPEPL PIFRTRGRTQ WIEADQLAQT LEAGSAQVVD VDSSLAFRRA HIAGARFVAA       420
     SALEDLLERI DADASRQLVL TSSDGVLAGL LANQLRERRE GVAALLGGTQ RWLALGLPQA       480
     SGDEGNLTGD DDAWYSPYHY APAQAAQQME AYLAWELQLV GQLERDGIAS INVIDFDTPT       540
     HRRSEERLAA LRRAN                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page