(data stored in ACNUC7421 zone)

EMBL: CP000271.PE614

CP000271.PE614       Location/Qualifiers
FT   CDS             718620..719984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2409"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2409"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33582"
FT                   /db_xref="GOA:Q13QQ7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ7"
FT                   /protein_id="ABE33582.1"
FT                   /translation="MSAARTLHLNTNITGTGRHPAGWRTLDNPKSIIDLGFFTTIAQIA
FT                   ERGKLDAVFLSDAVALRGHAHGPAQSLEPTVLLTALAGVTRHVGLIGTASTTFNDPFNL
FT                   ARRFASVDHLSAGRVAWNAVTTYDPEAAANFSIAESPDKQARYARAEEFVEVVLKLWDS
FT                   WEDNALIADRASGRYADPARVHAIAHAGRHFQVRGPLNLPRSPQGRPVLVQAGGSEAGV
FT                   ALAARHADAVFTAQTTFEGAQDFYRDIKARAVAHGRHPDHLLVLPGLYPVIGGTLAEAR
FT                   RRKADMDALLDRGAELAKFAGALGIDAAALQLDAPLPYDLIDKGDRTDVSRGFIRSTVL
FT                   LARGENLTVRDLLDRNPGAHRMIVGTPETIADDIERWFAGRAADGFNLNADVFPSGLAD
FT                   FVDHVVPLLQRKGIFRREYEGTTLRDHYGLARPSSRYADAATSAVADADALGAVS"
     MSAARTLHLN TNITGTGRHP AGWRTLDNPK SIIDLGFFTT IAQIAERGKL DAVFLSDAVA        60
     LRGHAHGPAQ SLEPTVLLTA LAGVTRHVGL IGTASTTFND PFNLARRFAS VDHLSAGRVA       120
     WNAVTTYDPE AAANFSIAES PDKQARYARA EEFVEVVLKL WDSWEDNALI ADRASGRYAD       180
     PARVHAIAHA GRHFQVRGPL NLPRSPQGRP VLVQAGGSEA GVALAARHAD AVFTAQTTFE       240
     GAQDFYRDIK ARAVAHGRHP DHLLVLPGLY PVIGGTLAEA RRRKADMDAL LDRGAELAKF       300
     AGALGIDAAA LQLDAPLPYD LIDKGDRTDV SRGFIRSTVL LARGENLTVR DLLDRNPGAH       360
     RMIVGTPETI ADDIERWFAG RAADGFNLNA DVFPSGLADF VDHVVPLLQR KGIFRREYEG       420
     TTLRDHYGLA RPSSRYADAA TSAVADADAL GAVS                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page