(data stored in ACNUC7421 zone)

EMBL: CP000271.PE615

CP000271.PE615       Location/Qualifiers
FT   CDS             720048..720875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2408"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2408"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33583"
FT                   /db_xref="GOA:Q13QQ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ6"
FT                   /protein_id="ABE33583.1"
FT                   /translation="MSTRESTFTAAPAPAPAATASRLATLREPLLRAAIPVLLIALWQL
FT                   ASTLGVVSEFVLPAPASVLTAYRELWQSGDLQDALKISLARAALGLLIGGGAGLLLGVA
FT                   AGLSKSAERGFDTVLQMLRTIPFIALVPIFVVWFGIGELSKVALIVGAAISPMYLSTYH
FT                   AIRGIDPKLLELGRTFRLTRGHQIRLIILPTALPGILVGVRYSAAISLLALVAAEQINA
FT                   SAGIGFILNNANQFQRTDIIIAGILVYAALGIAVDALLRFIERKALVWRGAHV"
     MSTRESTFTA APAPAPAATA SRLATLREPL LRAAIPVLLI ALWQLASTLG VVSEFVLPAP        60
     ASVLTAYREL WQSGDLQDAL KISLARAALG LLIGGGAGLL LGVAAGLSKS AERGFDTVLQ       120
     MLRTIPFIAL VPIFVVWFGI GELSKVALIV GAAISPMYLS TYHAIRGIDP KLLELGRTFR       180
     LTRGHQIRLI ILPTALPGIL VGVRYSAAIS LLALVAAEQI NASAGIGFIL NNANQFQRTD       240
     IIIAGILVYA ALGIAVDALL RFIERKALVW RGAHV                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page