(data stored in ACNUC7421 zone)

EMBL: CP000271.PE616

CP000271.PE616       Location/Qualifiers
FT   CDS             720868..721605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2407"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2407"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33584"
FT                   /db_xref="GOA:Q13QQ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ5"
FT                   /protein_id="ABE33584.1"
FT                   /translation="MSELAYQPDYDAAPVVARLSGARKRYGENTVLDNVDFTVRKGECV
FT                   ALVGPSGTGKTTLLRLLAGLESVSGGRTEVTQNTSVVFQEPRLIQALRVWKNVLLDDAH
FT                   KPDAKARARVALQDVGLEDKLESWPVSLSGGQAQRVAVARALYRSPELMLLDEPFSALD
FT                   AFTRRSMQSLVLKLWAKYRFGLVIVTHDLDEALILADRIVILSKGRICHETQVDLPRER
FT                   DVTSPEFNALKRDLLKQFSLSLS"
     MSELAYQPDY DAAPVVARLS GARKRYGENT VLDNVDFTVR KGECVALVGP SGTGKTTLLR        60
     LLAGLESVSG GRTEVTQNTS VVFQEPRLIQ ALRVWKNVLL DDAHKPDAKA RARVALQDVG       120
     LEDKLESWPV SLSGGQAQRV AVARALYRSP ELMLLDEPFS ALDAFTRRSM QSLVLKLWAK       180
     YRFGLVIVTH DLDEALILAD RIVILSKGRI CHETQVDLPR ERDVTSPEFN ALKRDLLKQF       240
     SLSLS                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page