(data stored in ACNUC7421 zone)

EMBL: CP000271.PE617

CP000271.PE617       Location/Qualifiers
FT   CDS             721636..722682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2406"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2406"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33585"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ4"
FT                   /protein_id="ABE33585.1"
FT                   /translation="MSLKKSLFAGMAVFLAAATLTLSGTAAAQTTPDLKGTKLVIAYQD
FT                   PAFPALIRKSGVVNGTPYQIEWVLLTGPAANLSALYANRIDLGHMGDTSLTIEQANART
FT                   EWTKESTPLRIVAGWRNFYSKDYPPVVTAVRTSAGINTVQEIKGHKVGYNYGGYNHSQY
FT                   LATLVKAGLTEKDIQPIKFADGATSAAGFNAGEVDVYAGALGPILPTIKSGAGRILLLD
FT                   RDTQIPALNVWTTTSTVLKDPTKVAALRDYFSRLSGYWQWHDTHKDEVIGVLKDTLKVS
FT                   DERAAFEYEVRSGSFVKFDSGLIGQEQKIADILYDGHAIRKKVDVAVEYDPQFNAVQKA
FT                   VWPIKVKN"
     MSLKKSLFAG MAVFLAAATL TLSGTAAAQT TPDLKGTKLV IAYQDPAFPA LIRKSGVVNG        60
     TPYQIEWVLL TGPAANLSAL YANRIDLGHM GDTSLTIEQA NARTEWTKES TPLRIVAGWR       120
     NFYSKDYPPV VTAVRTSAGI NTVQEIKGHK VGYNYGGYNH SQYLATLVKA GLTEKDIQPI       180
     KFADGATSAA GFNAGEVDVY AGALGPILPT IKSGAGRILL LDRDTQIPAL NVWTTTSTVL       240
     KDPTKVAALR DYFSRLSGYW QWHDTHKDEV IGVLKDTLKV SDERAAFEYE VRSGSFVKFD       300
     SGLIGQEQKI ADILYDGHAI RKKVDVAVEY DPQFNAVQKA VWPIKVKN                    348
//

If you have problems or comments...

PBIL Back to PBIL home page