(data stored in ACNUC7421 zone)

EMBL: CP000271.PE618

CP000271.PE618       Location/Qualifiers
FT   CDS             722776..724392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2405"
FT                   /product="putative rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2405"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33586"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ3"
FT                   /protein_id="ABE33586.1"
FT                   /translation="MDVRKMPKGIDAATLKRWLHDGSEIALFDVREHGQYGEGHPFYAV
FT                   PLPYSVLERDVGRLAPNRRVRVVVYDSGDGDDGPAARAAARLETLGYASVHVLEGGTRA
FT                   WQDAGFVLFKGVNVPSKAFGELVEQVAHTPHISAQTLLQWQQSDTPPVVLDGRPLGEYR
FT                   TMNIPGASCCPNGELAYRIDAFVPDAQTPIVINCAGRTRSIIGAQTLLDLGIRNPVYAL
FT                   ENGTQGWFLADLPLERGQQRGYPADLRPQPARVAAARALAERAGVEWVHADTVRDWTKA
FT                   DDRTLYLCDVRTPEEFAANTLPGAQHAPGGQLQQATDQYIGVRNARIVLFDDDGIRAPV
FT                   TASWLRQLGHEAWVLEGGLHSGLALADTRIPEPAALPLVDGDTLAQRLAAGSQSVVDLR
FT                   TSAAWLAAHIPGSVWSIRPRLAATLAQCEQAVTFVVDDPRIAAWAVSDLAGGEGHTFSV
FT                   LDGGFAAWPAGGWRVETDAVADVLPPSARIDYLFFTHDRHAGNKAASREYLSWELGLLG
FT                   QLDELERSAFRPLTRVVAAPE"
     MDVRKMPKGI DAATLKRWLH DGSEIALFDV REHGQYGEGH PFYAVPLPYS VLERDVGRLA        60
     PNRRVRVVVY DSGDGDDGPA ARAAARLETL GYASVHVLEG GTRAWQDAGF VLFKGVNVPS       120
     KAFGELVEQV AHTPHISAQT LLQWQQSDTP PVVLDGRPLG EYRTMNIPGA SCCPNGELAY       180
     RIDAFVPDAQ TPIVINCAGR TRSIIGAQTL LDLGIRNPVY ALENGTQGWF LADLPLERGQ       240
     QRGYPADLRP QPARVAAARA LAERAGVEWV HADTVRDWTK ADDRTLYLCD VRTPEEFAAN       300
     TLPGAQHAPG GQLQQATDQY IGVRNARIVL FDDDGIRAPV TASWLRQLGH EAWVLEGGLH       360
     SGLALADTRI PEPAALPLVD GDTLAQRLAA GSQSVVDLRT SAAWLAAHIP GSVWSIRPRL       420
     AATLAQCEQA VTFVVDDPRI AAWAVSDLAG GEGHTFSVLD GGFAAWPAGG WRVETDAVAD       480
     VLPPSARIDY LFFTHDRHAG NKAASREYLS WELGLLGQLD ELERSAFRPL TRVVAAPE         538
//

If you have problems or comments...

PBIL Back to PBIL home page