(data stored in ACNUC7421 zone)

EMBL: CP000271.PE620

CP000271.PE620       Location/Qualifiers
FT   CDS             725139..725828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2403"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33588"
FT                   /db_xref="GOA:Q13QQ1"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ1"
FT                   /protein_id="ABE33588.1"
FT                   /translation="MAKVMVVGQGRPAKRKVDPWFPEIRSHYLASFLNRGEFNRMRDVI
FT                   RAFVATRVPNRRRLEARLFESGIMMRAINLFFLLFFTCTAVYSSESIYGSAFDYKKAKP
FT                   ANIYFSGKTQAEIKIYCEKVASATIDLSVCAQFRFEGVAQELDRKFREIEKEIVIGDKD
FT                   RRAIGEPEATPYLKKAQANWKRYRDNQCYARTYEVGQASLRFVEFWDCMARVTRNRLNE
FT                   LTTANEE"
     MAKVMVVGQG RPAKRKVDPW FPEIRSHYLA SFLNRGEFNR MRDVIRAFVA TRVPNRRRLE        60
     ARLFESGIMM RAINLFFLLF FTCTAVYSSE SIYGSAFDYK KAKPANIYFS GKTQAEIKIY       120
     CEKVASATID LSVCAQFRFE GVAQELDRKF REIEKEIVIG DKDRRAIGEP EATPYLKKAQ       180
     ANWKRYRDNQ CYARTYEVGQ ASLRFVEFWD CMARVTRNRL NELTTANEE                   229
//

If you have problems or comments...

PBIL Back to PBIL home page