(data stored in ACNUC7421 zone)

EMBL: CP000271.PE621

CP000271.PE621       Location/Qualifiers
FT   CDS             725973..726230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2402"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33589"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QQ0"
FT                   /protein_id="ABE33589.1"
FT                   /translation="MRREICSRTGVMIRVIKAIISAIGFVFATAVFADVACEKHEKTCD
FT                   DFLKCSQIDADKILSDSKKLYLKVREFAKGDKRAALDRNY"
     MRREICSRTG VMIRVIKAII SAIGFVFATA VFADVACEKH EKTCDDFLKC SQIDADKILS        60
     DSKKLYLKVR EFAKGDKRAA LDRNY                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page