(data stored in ACNUC7421 zone)

EMBL: CP000271.PE622

CP000271.PE622       Location/Qualifiers
FT   CDS             726466..726768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2401"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33590"
FT                   /db_xref="GOA:Q13QP9"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP9"
FT                   /protein_id="ABE33590.1"
FT                   /translation="MTRRFSLIAFLLAFLYEASVEAVLLWSLPLKPTGWGAIIASLTTN
FT                   PLAFVYAMKRRKWAFDLLKWIAAFSIVWTVSGFVRKETAKYNPLAILYLLSLIRE"
     MTRRFSLIAF LLAFLYEASV EAVLLWSLPL KPTGWGAIIA SLTTNPLAFV YAMKRRKWAF        60
     DLLKWIAAFS IVWTVSGFVR KETAKYNPLA ILYLLSLIRE                             100
//

If you have problems or comments...

PBIL Back to PBIL home page