(data stored in ACNUC7421 zone)

EMBL: CP000271.PE624

CP000271.PE624       Location/Qualifiers
FT   CDS             complement(728259..728681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33592"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP7"
FT                   /protein_id="ABE33592.1"
FT                   /translation="MEFDSDWLTLGRHRVRLRSPRGFPTEGMRTAVDVMRLAIENNMSA
FT                   RARLVDVAVREEKSYDVSVGTTFAEDRLCVPQLEAAIAVVLGLLPGQIRIFVTVVTQEE
FT                   VDLHFGVYERMLAEKIGGLAPISQAYSANASNASDG"
     MEFDSDWLTL GRHRVRLRSP RGFPTEGMRT AVDVMRLAIE NNMSARARLV DVAVREEKSY        60
     DVSVGTTFAE DRLCVPQLEA AIAVVLGLLP GQIRIFVTVV TQEEVDLHFG VYERMLAEKI       120
     GGLAPISQAY SANASNASDG                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page