(data stored in ACNUC7421 zone)

EMBL: CP000271.PE625

CP000271.PE625       Location/Qualifiers
FT   CDS             728934..729377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2398"
FT                   /product="Putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33593"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP6"
FT                   /protein_id="ABE33593.1"
FT                   /translation="MSDLYFTTDLFSQFDRLHQQMATLFGGYPSSIRSDRLSAFPQINI
FT                   GTTDDTIDIVAFAPGIDPKQLEVSIDKGLLTIAGERAAVTPDASDEAARHYARERFSGA
FT                   FRRVIELPQHADPDKVEARYVNGCLCITVGKRESSRPRAITVQ"
     MSDLYFTTDL FSQFDRLHQQ MATLFGGYPS SIRSDRLSAF PQINIGTTDD TIDIVAFAPG        60
     IDPKQLEVSI DKGLLTIAGE RAAVTPDASD EAARHYARER FSGAFRRVIE LPQHADPDKV       120
     EARYVNGCLC ITVGKRESSR PRAITVQ                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page