(data stored in ACNUC7421 zone)

EMBL: CP000271.PE626

CP000271.PE626       Location/Qualifiers
FT   CDS             729403..729810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2397"
FT                   /product="Putative heat shock Hsp20-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2397"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33594"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP5"
FT                   /protein_id="ABE33594.1"
FT                   /translation="MNDTTQLARRDSNTVSRAEPERTEQRVTLSPAVDVIENAHGVTLW
FT                   ADLPGVPRENLEIRVQDGNLRIEASANIPTREGLRLQHAEVRVPHFARSFTLGPEFDTS
FT                   KIEAKLQDGVLKLSIPRREEARPRRIEVAVG"
     MNDTTQLARR DSNTVSRAEP ERTEQRVTLS PAVDVIENAH GVTLWADLPG VPRENLEIRV        60
     QDGNLRIEAS ANIPTREGLR LQHAEVRVPH FARSFTLGPE FDTSKIEAKL QDGVLKLSIP       120
     RREEARPRRI EVAVG                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page