(data stored in ACNUC7421 zone)

EMBL: CP000271.PE627

CP000271.PE627       Location/Qualifiers
FT   CDS             730668..730991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2394"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33595"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QP4"
FT                   /protein_id="ABE33595.1"
FT                   /translation="MMRLRCLLARLGGLCRGSDSRYNRPRRSRTGRPASWLRAMRGRHR
FT                   NAVGQTRSREVIAAGQARKGEDSDSFASRRASFRCSSVQMNDGASQRIAGPAKYPEAAL
FT                   KRC"
     MMRLRCLLAR LGGLCRGSDS RYNRPRRSRT GRPASWLRAM RGRHRNAVGQ TRSREVIAAG        60
     QARKGEDSDS FASRRASFRC SSVQMNDGAS QRIAGPAKYP EAALKRC                     107
//

If you have problems or comments...

PBIL Back to PBIL home page