(data stored in SCRATCH zone)

EMBL: CP000271.PE63

CP000271.PE63        Location/Qualifiers
FT   CDS             71907..72956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2964"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2964"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33031"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA8"
FT                   /protein_id="ABE33031.1"
FT                   /translation="MSFAKEPHAARRLFRSSLSAAAAAVCFAGLGVTGAAQAADAGKIG
FT                   LDLPLLTSPFWQSYNNYLPKYAKDMGLDILAPVNSNGDPAQQITDMNNLLNLGAKGIVV
FT                   GPLDSAAISRALDAAAAKNVPVVAVDVAPTQGKVAMVVRADNRAYGEKACKYIGDHVKS
FT                   GKVVQIMGDLASVNGRDRSEAFRSCMKGYPGVSVLEIPAAWKGDVAATALDSLLTANPD
FT                   VKGIYMQAGGVYLSPTLQTLRRKQMLFPAGDPKHVVIVSNDGIPQEFDAIRRGDIDATV
FT                   SQPADSYAKYGLFYIKAALAGQTFKPGPTDHGSNIIQLAPGVLEDQLPAPLVTKSNVDD
FT                   KALWGNTVK"
     MSFAKEPHAA RRLFRSSLSA AAAAVCFAGL GVTGAAQAAD AGKIGLDLPL LTSPFWQSYN        60
     NYLPKYAKDM GLDILAPVNS NGDPAQQITD MNNLLNLGAK GIVVGPLDSA AISRALDAAA       120
     AKNVPVVAVD VAPTQGKVAM VVRADNRAYG EKACKYIGDH VKSGKVVQIM GDLASVNGRD       180
     RSEAFRSCMK GYPGVSVLEI PAAWKGDVAA TALDSLLTAN PDVKGIYMQA GGVYLSPTLQ       240
     TLRRKQMLFP AGDPKHVVIV SNDGIPQEFD AIRRGDIDAT VSQPADSYAK YGLFYIKAAL       300
     AGQTFKPGPT DHGSNIIQLA PGVLEDQLPA PLVTKSNVDD KALWGNTVK                   349
//

If you have problems or comments...

PBIL Back to PBIL home page