(data stored in ACNUC7421 zone)

EMBL: CP000271.PE633

CP000271.PE633       Location/Qualifiers
FT   CDS             736048..737928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2388"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2388"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33601"
FT                   /db_xref="GOA:Q13QN8"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN8"
FT                   /protein_id="ABE33601.1"
FT                   /translation="MRFAMNSSTSGLTPAEVVFFNGKIATQDDRRSFADSLAVANGRVL
FT                   AAGSRETVMRHANDNTRHVDLKGRTVIPGLNDSHLHIIRGGLNFNMELRWDGVPSLADA
FT                   LDMLRKQVARTPAPQWVRVVGGWNEFQFAERRGPTLEEINAIAPDTPVFILHLYDSALL
FT                   NAAALRAVGYTKDTPNPPGGEIQRDKRGNPTGMLIARPNAGLLYATLAKGPKLAPEDQR
FT                   NSTRHFMRELNRLGVTSAIDAGGGYQAYPDDYAVIVEMAKHSELTVRIAYNLFTQNAKK
FT                   EIEDFAKWVKMTRPGEGDDFLRVNGAGEMLVFSAADFEDFLEPRPDLPESLETELEAVV
FT                   RLLVANRWPFRLHATYNESIERFLNVFERVNAEIPFNGLRWFFDHCETITQQNIERVKA
FT                   LGGGIAIQHRMAYQGEYFIHQYGEEAVKRTPPVRHMLDAGLPVGAGTDATRVASFNPFV
FT                   SLYWMVSGKTVGGTAMYGSENRLDRMEALRRYTVGSAWFSNEEEKKGALVPGQFADFAV
FT                   LSEDFFSIDESRIKYLTSNMTVVGGKVVYADDEFAPLAPPDLPVSPSWSPVAEFGGYSR
FT                   YKPTAVACVDGCVNLCGVHAHAHGWAWRKNVPVSDSNGFWGALGCSCFAF"
     MRFAMNSSTS GLTPAEVVFF NGKIATQDDR RSFADSLAVA NGRVLAAGSR ETVMRHANDN        60
     TRHVDLKGRT VIPGLNDSHL HIIRGGLNFN MELRWDGVPS LADALDMLRK QVARTPAPQW       120
     VRVVGGWNEF QFAERRGPTL EEINAIAPDT PVFILHLYDS ALLNAAALRA VGYTKDTPNP       180
     PGGEIQRDKR GNPTGMLIAR PNAGLLYATL AKGPKLAPED QRNSTRHFMR ELNRLGVTSA       240
     IDAGGGYQAY PDDYAVIVEM AKHSELTVRI AYNLFTQNAK KEIEDFAKWV KMTRPGEGDD       300
     FLRVNGAGEM LVFSAADFED FLEPRPDLPE SLETELEAVV RLLVANRWPF RLHATYNESI       360
     ERFLNVFERV NAEIPFNGLR WFFDHCETIT QQNIERVKAL GGGIAIQHRM AYQGEYFIHQ       420
     YGEEAVKRTP PVRHMLDAGL PVGAGTDATR VASFNPFVSL YWMVSGKTVG GTAMYGSENR       480
     LDRMEALRRY TVGSAWFSNE EEKKGALVPG QFADFAVLSE DFFSIDESRI KYLTSNMTVV       540
     GGKVVYADDE FAPLAPPDLP VSPSWSPVAE FGGYSRYKPT AVACVDGCVN LCGVHAHAHG       600
     WAWRKNVPVS DSNGFWGALG CSCFAF                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page