(data stored in ACNUC7421 zone)

EMBL: CP000271.PE635

CP000271.PE635       Location/Qualifiers
FT   CDS             739632..740273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2386"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2386"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33603"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN6"
FT                   /protein_id="ABE33603.1"
FT                   /translation="MKKTIAGVDIPDGVMAQAATDLIRGTESELMFHHALRAFLFAALT
FT                   GYRENLTFDAQLLYVGAMFHNVGLNAKYERSPYRFEVDGANAARDFLRRHGVAEREIEE
FT                   VWVGIALHTTPGIPEHLSALVALISAGVQMDVRGARYDEFTAHQRDEIVQAYPRESGFK
FT                   KKLIEAYAHGMEHRPETTFGTVNADVLDRWDPNYRRLNFCGLVLGSDWPN"
     MKKTIAGVDI PDGVMAQAAT DLIRGTESEL MFHHALRAFL FAALTGYREN LTFDAQLLYV        60
     GAMFHNVGLN AKYERSPYRF EVDGANAARD FLRRHGVAER EIEEVWVGIA LHTTPGIPEH       120
     LSALVALISA GVQMDVRGAR YDEFTAHQRD EIVQAYPRES GFKKKLIEAY AHGMEHRPET       180
     TFGTVNADVL DRWDPNYRRL NFCGLVLGSD WPN                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page