(data stored in ACNUC7421 zone)

EMBL: CP000271.PE636

CP000271.PE636       Location/Qualifiers
FT   CDS             740302..740544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2385"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2385"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33604"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN5"
FT                   /protein_id="ABE33604.1"
FT                   /translation="MGYIISLGVGFGIGLLYWLLKVQSPAPPLIALAGLLGMVLGEHAI
FT                   PVVKAQFFAQTTTAQVAGQTKDAAVQKPDASKEGG"
     MGYIISLGVG FGIGLLYWLL KVQSPAPPLI ALAGLLGMVL GEHAIPVVKA QFFAQTTTAQ        60
     VAGQTKDAAV QKPDASKEGG                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page