(data stored in ACNUC7421 zone)

EMBL: CP000271.PE637

CP000271.PE637       Location/Qualifiers
FT   CDS             740617..741576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2384"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2384"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33605"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN4"
FT                   /protein_id="ABE33605.1"
FT                   /translation="MDIQMFKSLHRYRAIALVSAALLIGSTAASSAFADAGPPEVSSGK
FT                   TALVKHPDVSVGAQYDTTHVYVASADLDAFVNSFLATFGGKASPRAVFTVTPTPSKTAS
FT                   QYVQTPVGMLSVFGFETPIPYPFGNERTGYLVTDIDQGVKAARAAGADVLVESFDDPIG
FT                   KDAIIQWPGGLTMQLYWHTKAPNYAPLQSVPDNRVYVSRYEANNFVRRWLHFSHGKVVS
FT                   DNPRADAGVIGRPGETIREIRIASGFGRMIVFVTDGKLPFPFGRETTGYNVDDVAQTLE
FT                   RAQAAGAKVLYPAYAVGSGKTAMLEFPGGYIAEVHDGK"
     MDIQMFKSLH RYRAIALVSA ALLIGSTAAS SAFADAGPPE VSSGKTALVK HPDVSVGAQY        60
     DTTHVYVASA DLDAFVNSFL ATFGGKASPR AVFTVTPTPS KTASQYVQTP VGMLSVFGFE       120
     TPIPYPFGNE RTGYLVTDID QGVKAARAAG ADVLVESFDD PIGKDAIIQW PGGLTMQLYW       180
     HTKAPNYAPL QSVPDNRVYV SRYEANNFVR RWLHFSHGKV VSDNPRADAG VIGRPGETIR       240
     EIRIASGFGR MIVFVTDGKL PFPFGRETTG YNVDDVAQTL ERAQAAGAKV LYPAYAVGSG       300
     KTAMLEFPGG YIAEVHDGK                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page