(data stored in ACNUC7421 zone)

EMBL: CP000271.PE638

CP000271.PE638       Location/Qualifiers
FT   CDS             741584..743092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2383"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2383"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33606"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QN3"
FT                   /protein_id="ABE33606.1"
FT                   /translation="MVPSFTLRRARRRARHAIRALLLSTGLAAALPAAAADTALGGADD
FT                   TSTTGSPAAATTAAGAAAASCARPAIMFNRWQENWSVLANPCVPKKPFDSLKYIPLFGN
FT                   PDAYISLGMVLRERLEINDAPLFGLGAQHDDTYLLQRLEVHADVRLGPHVQIFTQFEDA
FT                   QPYGKDVVTPVDKNPLDLRQAFVAITEPLGPGTVKFRVGRQEMAFDLQRFVSVRDGPNV
FT                   RQAFDAIWADYETGPWRWIAYATQPVQYRDNSDFDDVSNRDLTFSGVRVERKNVGPGDL
FT                   SAYYSRYNRSNAKFLDASGDEHRDVFDARYAGNVAPIDWDVEAMYQSGHVGNKTIGAWA
FT                   VGSLAGYTLASLPWTPRLGIQIDAASGDSHPGDGRIGTFNPLFPNGYYFALAGYTGYTN
FT                   LVHVKPTLILKPSSKLTLLAGVGLQWRQTTADAVYGQGSAVVPGTAGHGSPWTGFYTQL
FT                   RADYAVTANLAAALEAVHFQVGPSLRDLGARNADYVGAELKFGW"
     MVPSFTLRRA RRRARHAIRA LLLSTGLAAA LPAAAADTAL GGADDTSTTG SPAAATTAAG        60
     AAAASCARPA IMFNRWQENW SVLANPCVPK KPFDSLKYIP LFGNPDAYIS LGMVLRERLE       120
     INDAPLFGLG AQHDDTYLLQ RLEVHADVRL GPHVQIFTQF EDAQPYGKDV VTPVDKNPLD       180
     LRQAFVAITE PLGPGTVKFR VGRQEMAFDL QRFVSVRDGP NVRQAFDAIW ADYETGPWRW       240
     IAYATQPVQY RDNSDFDDVS NRDLTFSGVR VERKNVGPGD LSAYYSRYNR SNAKFLDASG       300
     DEHRDVFDAR YAGNVAPIDW DVEAMYQSGH VGNKTIGAWA VGSLAGYTLA SLPWTPRLGI       360
     QIDAASGDSH PGDGRIGTFN PLFPNGYYFA LAGYTGYTNL VHVKPTLILK PSSKLTLLAG       420
     VGLQWRQTTA DAVYGQGSAV VPGTAGHGSP WTGFYTQLRA DYAVTANLAA ALEAVHFQVG       480
     PSLRDLGARN ADYVGAELKF GW                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page