(data stored in SCRATCH zone)

EMBL: CP000271.PE64

CP000271.PE64        Location/Qualifiers
FT   CDS             72953..74473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2963"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2963"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33032"
FT                   /db_xref="GOA:Q13SA7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA7"
FT                   /protein_id="ABE33032.1"
FT                   /translation="MSELTPSAPVVEAFEITKRFGSTAALKDVSIRVMPGESHALVGRN
FT                   GAGKSTLVSILTGLRKPDTGEVRFSGVAAPSIADRDAWRERVACVYQHSTIIRDLSVAE
FT                   NLFINRQPLRGGMIDWQAMRRDARTLLDHWKIDVREDARAGDLTVEARQLVEIARALSY
FT                   GARFIILDEPTAQLDGDEIKRLFRRISELQREGVTFLFISHHLQEVYEICQAVTVLRDA
FT                   RHIVSAPVSALPREQLIEAMTGERGGLAVADAAARDALPADTAIALQVESLAGSDYEGV
FT                   SFTVKRGEVVGLTGATSSGRTSVAEAIAGLRAAKRGTIRVDGKTLPPGDVPAALAHGVG
FT                   CVPKDRHHEGLVLTQSVAENASMTIARLLGKFGIAPPAKKNAFGQKMIDALGIVAQGPE
FT                   HVVSGLSGGNQQKVVMARALATNPNVLVLIDPTAGVDVKSKEALLSVVDRVREDGKAVL
FT                   VVSGELDDLRTCDRVLVMFRGRVAAEFPAGWQDHDLIASVEGVSLHEE"
     MSELTPSAPV VEAFEITKRF GSTAALKDVS IRVMPGESHA LVGRNGAGKS TLVSILTGLR        60
     KPDTGEVRFS GVAAPSIADR DAWRERVACV YQHSTIIRDL SVAENLFINR QPLRGGMIDW       120
     QAMRRDARTL LDHWKIDVRE DARAGDLTVE ARQLVEIARA LSYGARFIIL DEPTAQLDGD       180
     EIKRLFRRIS ELQREGVTFL FISHHLQEVY EICQAVTVLR DARHIVSAPV SALPREQLIE       240
     AMTGERGGLA VADAAARDAL PADTAIALQV ESLAGSDYEG VSFTVKRGEV VGLTGATSSG       300
     RTSVAEAIAG LRAAKRGTIR VDGKTLPPGD VPAALAHGVG CVPKDRHHEG LVLTQSVAEN       360
     ASMTIARLLG KFGIAPPAKK NAFGQKMIDA LGIVAQGPEH VVSGLSGGNQ QKVVMARALA       420
     TNPNVLVLID PTAGVDVKSK EALLSVVDRV REDGKAVLVV SGELDDLRTC DRVLVMFRGR       480
     VAAEFPAGWQ DHDLIASVEG VSLHEE                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page