(data stored in ACNUC7421 zone)

EMBL: CP000271.PE648

CP000271.PE648       Location/Qualifiers
FT   CDS             757413..757850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2373"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33616"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM3"
FT                   /protein_id="ABE33616.1"
FT                   /translation="MKAKWTLVFLAASAFGAVCQQATAQVAGAQPIGITVEQAQLVVEG
FT                   WSVKKSLLGKSIYNDSGEKVGVLHDIIVAPDNAVSFGIVAAHQFLGVSQHDVAVPMSQL
FT                   DYANGKLVWAGATREVVKSLPVFIYSKVRTVPIARKDYGHH"
     MKAKWTLVFL AASAFGAVCQ QATAQVAGAQ PIGITVEQAQ LVVEGWSVKK SLLGKSIYND        60
     SGEKVGVLHD IIVAPDNAVS FGIVAAHQFL GVSQHDVAVP MSQLDYANGK LVWAGATREV       120
     VKSLPVFIYS KVRTVPIARK DYGHH                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page