(data stored in ACNUC7421 zone)

EMBL: CP000271.PE65

CP000271.PE65        Location/Qualifiers
FT   CDS             74463..75512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2962"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2962"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33033"
FT                   /db_xref="GOA:Q13SA6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA6"
FT                   /protein_id="ABE33033.1"
FT                   /translation="MKNSVPSPAFGTAQAQAQPLAQATRGKRARSELARLRELALLPAL
FT                   ALLIVIGAFVSPSFLTKANLISVLGASAALALVVLAESLIVLTGKFDLSLESTVGIAPA
FT                   VGAMLVMPAASAGFGMQWPAAAGLLAIVAVGAVIGFINGFLVVRLRLNAFIVTLAMLIV
FT                   LRGMLVGATKGGTLFDMPPSFFTLATTIVFGLPLSVWLAAVAFAIAAFVLRYHRLGRAL
FT                   YAIGGNPEAARAAGIRVERITWGVFVLGSMLASLGGLIVTGYVGAINANQGNGMIFTVF
FT                   AAAVIGGISLDGGKGTMFGALTGVLLLGVVQNLLTLAQVPSFWIQAIYGAIILGSLMVA
FT                   RLASGEGQN"
     MKNSVPSPAF GTAQAQAQPL AQATRGKRAR SELARLRELA LLPALALLIV IGAFVSPSFL        60
     TKANLISVLG ASAALALVVL AESLIVLTGK FDLSLESTVG IAPAVGAMLV MPAASAGFGM       120
     QWPAAAGLLA IVAVGAVIGF INGFLVVRLR LNAFIVTLAM LIVLRGMLVG ATKGGTLFDM       180
     PPSFFTLATT IVFGLPLSVW LAAVAFAIAA FVLRYHRLGR ALYAIGGNPE AARAAGIRVE       240
     RITWGVFVLG SMLASLGGLI VTGYVGAINA NQGNGMIFTV FAAAVIGGIS LDGGKGTMFG       300
     ALTGVLLLGV VQNLLTLAQV PSFWIQAIYG AIILGSLMVA RLASGEGQN                   349
//

If you have problems or comments...

PBIL Back to PBIL home page