(data stored in ACNUC7421 zone)

EMBL: CP000271.PE651

CP000271.PE651       Location/Qualifiers
FT   CDS             760705..762027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2370"
FT                   /product="Putative phthalate 4,5-dioxygenase oxygenase
FT                   subunit (OhpA2)"
FT                   /note="Citation: J. Bacteriol. 180 (24), 6529-6537 (1998)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2370"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33619"
FT                   /db_xref="GOA:Q13QM0"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QM0"
FT                   /protein_id="ABE33619.1"
FT                   /translation="MLSHEDNETLVRVGPGTPTGQFMRLYWLPFLPSSDLTVDGQPQRV
FT                   RLLGEDLIAFRDSEGRVGLVDHVCPHRGAPLVFGRNENCGLRCVYHGWQFGVDGQVIDT
FT                   PAEPAESRLKDKVRIRSYPCRERNGIVWAYMGEADANALPPLPNLEWNMVPLENVHFSF
FT                   RVQECNWLQAVEGEIDSAHAPILHGRIDSQGAINEWTAKRDLRPVFECQRREFGISIAS
FT                   RRVLDDSHHYWRVNQFLFPFYTLVPPQSKYPELSGHAWVPVDDENTLCLMFSYTPAAPL
FT                   YEKTRKLFEDGHAGRETGHASAHAFAPRPVTQPYAKYWTRFNLESAFQFDYDAQTKTWF
FT                   SGLPGLWVQDAACQSGVAPIYDRRKENLGISDTGVAMTRRLLLENVRKLASERVSPVRV
FT                   DDPDLWMVRAVSLTLPAGAPWQSDGAEHMRARLGADFGYTP"
     MLSHEDNETL VRVGPGTPTG QFMRLYWLPF LPSSDLTVDG QPQRVRLLGE DLIAFRDSEG        60
     RVGLVDHVCP HRGAPLVFGR NENCGLRCVY HGWQFGVDGQ VIDTPAEPAE SRLKDKVRIR       120
     SYPCRERNGI VWAYMGEADA NALPPLPNLE WNMVPLENVH FSFRVQECNW LQAVEGEIDS       180
     AHAPILHGRI DSQGAINEWT AKRDLRPVFE CQRREFGISI ASRRVLDDSH HYWRVNQFLF       240
     PFYTLVPPQS KYPELSGHAW VPVDDENTLC LMFSYTPAAP LYEKTRKLFE DGHAGRETGH       300
     ASAHAFAPRP VTQPYAKYWT RFNLESAFQF DYDAQTKTWF SGLPGLWVQD AACQSGVAPI       360
     YDRRKENLGI SDTGVAMTRR LLLENVRKLA SERVSPVRVD DPDLWMVRAV SLTLPAGAPW       420
     QSDGAEHMRA RLGADFGYTP                                                   440
//

If you have problems or comments...

PBIL Back to PBIL home page