(data stored in ACNUC7421 zone)

EMBL: CP000271.PE652

CP000271.PE652       Location/Qualifiers
FT   CDS             762054..763016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2369"
FT                   /product="Putative phthalate 4,5-dioxygenase reductase
FT                   subunit (OhpA1)"
FT                   /note="Citation: J. Bacteriol. 180 (24), 6529-6537 (1998)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2369"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33620"
FT                   /db_xref="GOA:Q13QL9"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL9"
FT                   /protein_id="ABE33620.1"
FT                   /translation="MSQHNADRIDVRLTQIRLEADDVASYEFRPIGTPVLPAFEAGAHI
FT                   DLYLPENRVRSYSLVNAPHERHRYVIAVQREAAGRGGSAWMHRTPRVGDRFTIGAPMND
FT                   FPLCEAARQSVFICGGIGITPIVSMIRRLERTGASWQLHYAARERSRAAYADDLAQIDE
FT                   AGSRITMHLESEGGRLDLRRVVERAPADAHLYCCGPRGMVDAFIEACASRPRAQVHFER
FT                   FAAANESATAGGFDVVLGRDGRRIPVAPGKTILDTLLDHGVDVQYACSAGVCGTCRTGV
FT                   IDGVPDHRDDYLTDEEKAGNRAVMVCCSGSLSPTLVLDL"
     MSQHNADRID VRLTQIRLEA DDVASYEFRP IGTPVLPAFE AGAHIDLYLP ENRVRSYSLV        60
     NAPHERHRYV IAVQREAAGR GGSAWMHRTP RVGDRFTIGA PMNDFPLCEA ARQSVFICGG       120
     IGITPIVSMI RRLERTGASW QLHYAARERS RAAYADDLAQ IDEAGSRITM HLESEGGRLD       180
     LRRVVERAPA DAHLYCCGPR GMVDAFIEAC ASRPRAQVHF ERFAAANESA TAGGFDVVLG       240
     RDGRRIPVAP GKTILDTLLD HGVDVQYACS AGVCGTCRTG VIDGVPDHRD DYLTDEEKAG       300
     NRAVMVCCSG SLSPTLVLDL                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page