(data stored in ACNUC7421 zone)

EMBL: CP000271.PE653

CP000271.PE653       Location/Qualifiers
FT   CDS             763078..764385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2368"
FT                   /product="Putative L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2368"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33621"
FT                   /db_xref="GOA:Q13QL8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL8"
FT                   /protein_id="ABE33621.1"
FT                   /translation="MLSRLVNEFPEHEPRPANAPKALAGIRVVDFTHFIAGPFATMMLA
FT                   DMGAEVIKIEAPGRGDEFRYYPPAHPEDASIGGPYLWANRNKRSIALDLKSAEGRRIAR
FT                   ELVATADIVAENFSTGVMERLGLSYEACRELNPQVIYCSVSAYGREGAFADRLGFDPIA
FT                   QAESGFVSMNGYPDRLGVRALSPVMDISTAMMASNAMLGALVARERTGKGQAVEVSLFD
FT                   NAVLMTGYATVQHLFTGEEPRRHGNTSPDTCPSGVFKAADKAFYINCGNDKIFHRLANQ
FT                   VLEMPELAADPVLADRNGRIARRDELFRILDEAFIRHPWAHWQQRMRAASIPCGEVRTV
FT                   GEALRSPEARERKLVSRLEHPELGWLPNINLPFRFSETPIDDPSPAPRVGEHSRSILTE
FT                   VLGYSGEGADALLRSGSVYSCDQVVAAAGGAEVSAS"
     MLSRLVNEFP EHEPRPANAP KALAGIRVVD FTHFIAGPFA TMMLADMGAE VIKIEAPGRG        60
     DEFRYYPPAH PEDASIGGPY LWANRNKRSI ALDLKSAEGR RIARELVATA DIVAENFSTG       120
     VMERLGLSYE ACRELNPQVI YCSVSAYGRE GAFADRLGFD PIAQAESGFV SMNGYPDRLG       180
     VRALSPVMDI STAMMASNAM LGALVARERT GKGQAVEVSL FDNAVLMTGY ATVQHLFTGE       240
     EPRRHGNTSP DTCPSGVFKA ADKAFYINCG NDKIFHRLAN QVLEMPELAA DPVLADRNGR       300
     IARRDELFRI LDEAFIRHPW AHWQQRMRAA SIPCGEVRTV GEALRSPEAR ERKLVSRLEH       360
     PELGWLPNIN LPFRFSETPI DDPSPAPRVG EHSRSILTEV LGYSGEGADA LLRSGSVYSC       420
     DQVVAAAGGA EVSAS                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page