(data stored in ACNUC7421 zone)

EMBL: CP000271.PE654

CP000271.PE654       Location/Qualifiers
FT   CDS             764382..765563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2367"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2367"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33622"
FT                   /db_xref="GOA:Q13QL7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL7"
FT                   /protein_id="ABE33622.1"
FT                   /translation="MTERTLRGQVAVVGVGESEYYRAGHAPDPEFRLLLKAVLAACRDA
FT                   DIDPADIDGFASFADDRNDAVRIATALGVKRLRSTTMQWGGGGGGCAAAVANGAAAIMS
FT                   GMAQCVLVYRGLAQGQFGRFGQAAPRASISGEMAYQMPYGVLAPPQKFAMKVQRFMHEH
FT                   GVRREALRAIALASYQHAQANPRAVMHGKPLTAEAYDASRWIVEPFRLFDCCMENDGAG
FT                   ALLLVAAERAKDFPHRPVYLLGAASGGDWRAAASPHNAPHYASANYSGVSGDLYRMARV
FT                   SPADVGVVQSYENFTGGVAMALSEHGFFHPDEANDFLTPENLVAPSGKLPLNTSGGNLG
FT                   ECYVHGFELVIEAARQVRGESTSQAARHDVALVIGGPMVTPASSLLFGSAATL"
     MTERTLRGQV AVVGVGESEY YRAGHAPDPE FRLLLKAVLA ACRDADIDPA DIDGFASFAD        60
     DRNDAVRIAT ALGVKRLRST TMQWGGGGGG CAAAVANGAA AIMSGMAQCV LVYRGLAQGQ       120
     FGRFGQAAPR ASISGEMAYQ MPYGVLAPPQ KFAMKVQRFM HEHGVRREAL RAIALASYQH       180
     AQANPRAVMH GKPLTAEAYD ASRWIVEPFR LFDCCMENDG AGALLLVAAE RAKDFPHRPV       240
     YLLGAASGGD WRAAASPHNA PHYASANYSG VSGDLYRMAR VSPADVGVVQ SYENFTGGVA       300
     MALSEHGFFH PDEANDFLTP ENLVAPSGKL PLNTSGGNLG ECYVHGFELV IEAARQVRGE       360
     STSQAARHDV ALVIGGPMVT PASSLLFGSA ATL                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page