(data stored in ACNUC7421 zone)

EMBL: CP000271.PE655

CP000271.PE655       Location/Qualifiers
FT   CDS             765560..766018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2366"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33623"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL6"
FT                   /protein_id="ABE33623.1"
FT                   /translation="MTDSSASPTYLPAGLPAPVPEPDGLSAPYWAGLREEKLRVQRCAH
FT                   CRTWQFGPEWICHGCRTFDPAWHEVAPRGRIFSWERVWHPSHPALAQATPYLVVLVELP
FT                   HAGHVRMLGNLLGDPRQQVEMGAAVTGVFEHHAEAATPYSLLQWRLST"
     MTDSSASPTY LPAGLPAPVP EPDGLSAPYW AGLREEKLRV QRCAHCRTWQ FGPEWICHGC        60
     RTFDPAWHEV APRGRIFSWE RVWHPSHPAL AQATPYLVVL VELPHAGHVR MLGNLLGDPR       120
     QQVEMGAAVT GVFEHHAEAA TPYSLLQWRL ST                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page