(data stored in ACNUC7421 zone)

EMBL: CP000271.PE659

CP000271.PE659       Location/Qualifiers
FT   CDS             complement(770320..770634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2362"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33627"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QL2"
FT                   /protein_id="ABE33627.1"
FT                   /translation="MSIYILNEVCKKRVLVRCSRLTSKRSTVDFRTTKKRSTTNISGHP
FT                   KRGMLTFSPRVACPSSSFFSARCRKGRLAAGNLPAWEDRRAEWVAGDLLCEYCLGARGA
FT                   "
     MSIYILNEVC KKRVLVRCSR LTSKRSTVDF RTTKKRSTTN ISGHPKRGML TFSPRVACPS        60
     SSFFSARCRK GRLAAGNLPA WEDRRAEWVA GDLLCEYCLG ARGA                        104
//

If you have problems or comments...

PBIL Back to PBIL home page