(data stored in ACNUC7421 zone)

EMBL: CP000271.PE662

CP000271.PE662       Location/Qualifiers
FT   CDS             772680..773459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2359"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2359"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33630"
FT                   /db_xref="GOA:Q13QK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QK9"
FT                   /protein_id="ABE33630.1"
FT                   /translation="MNAVTTQAMFEKAATTRNAVEVEHVSKHYGKLAVLEDISLTAPSG
FT                   SVLAIVGASGCGKSTLLNIIAGLVQADQGDVRIDGVAGEPTHDTRVVSYMFQEDRLLPW
FT                   RTIVANTEFGLEAGSLNAERRRERALAALKMTGLEGFEHAYPHELSGGMRSRVALARSL
FT                   VVKPYILLMDEPFSKLDPQMRSQMHAELLRIREQLKMTVVFVTHDVEEAIVLADKVVVL
FT                   RPRPGRVRDTLTIDLPRPRDPLAAEVAETVRRVRALI"
     MNAVTTQAMF EKAATTRNAV EVEHVSKHYG KLAVLEDISL TAPSGSVLAI VGASGCGKST        60
     LLNIIAGLVQ ADQGDVRIDG VAGEPTHDTR VVSYMFQEDR LLPWRTIVAN TEFGLEAGSL       120
     NAERRRERAL AALKMTGLEG FEHAYPHELS GGMRSRVALA RSLVVKPYIL LMDEPFSKLD       180
     PQMRSQMHAE LLRIREQLKM TVVFVTHDVE EAIVLADKVV VLRPRPGRVR DTLTIDLPRP       240
     RDPLAAEVAE TVRRVRALI                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page