(data stored in ACNUC7421 zone)

EMBL: CP000271.PE663

CP000271.PE663       Location/Qualifiers
FT   CDS             773470..774279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2358"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2358"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33631"
FT                   /db_xref="GOA:Q13QK8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13QK8"
FT                   /protein_id="ABE33631.1"
FT                   /translation="MSSVSTASSVFPARFGRLTRFARVAGQRLSLLAIFLILWWVAAQR
FT                   VPAFILPGPGKTWNALLDLIATGTFAEDLGITLYRVVAGFLLAALVGTPLGILLGANRR
FT                   LGSFCEPVLSVVNTVSAAIWAIFALIWFGISNGTTIFVVFMEAMPLILTNVWQGAQSVN
FT                   AEYVELARSFQMSRSKVMTKIYLPTVLPYFFSGARLAFGFGWRVSLVAETIGSSNGVGY
FT                   RLRQAADLVQTDQVFAWTLTMVVLMVVLEYGILKPLENHLFRWKKRA"
     MSSVSTASSV FPARFGRLTR FARVAGQRLS LLAIFLILWW VAAQRVPAFI LPGPGKTWNA        60
     LLDLIATGTF AEDLGITLYR VVAGFLLAAL VGTPLGILLG ANRRLGSFCE PVLSVVNTVS       120
     AAIWAIFALI WFGISNGTTI FVVFMEAMPL ILTNVWQGAQ SVNAEYVELA RSFQMSRSKV       180
     MTKIYLPTVL PYFFSGARLA FGFGWRVSLV AETIGSSNGV GYRLRQAADL VQTDQVFAWT       240
     LTMVVLMVVL EYGILKPLEN HLFRWKKRA                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page