(data stored in ACNUC7421 zone)

EMBL: CP000271.PE68

CP000271.PE68        Location/Qualifiers
FT   CDS             77360..78400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2959"
FT                   /product="Putative aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2959"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33036"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA3"
FT                   /protein_id="ABE33036.1"
FT                   /translation="MTATIASKIGQRRRIGRTALQVTGLGLGTAPLGGLYRDLSDEEAH
FT                   ATIAAAWDAGVRYFDTAPHYGNTKAEHRLGDVLRRYPRGDYVLSTKVGRRFVPRTTPFD
FT                   DREGWQNPLPFEAIYDYTHDGILRSFEDSQQRLGIVDIDILLVHDIGRVTHGDNHPHYW
FT                   RQLTEGGGFRALDGLRSAGAIKAVGLGVNEGAVILDAMAEFDIDCALLAGRYTLLEQST
FT                   LDDLLPACETRGVSILLGGAFNSGILARGVEGDLKFNYGEAPREVIERVARLDAVCHAH
FT                   AVPLAAAALQFPYAHPAVATVLTGARSADELRENAASFGQPIPAGLWSALRDEGLLDSR
FT                   APVPED"
     MTATIASKIG QRRRIGRTAL QVTGLGLGTA PLGGLYRDLS DEEAHATIAA AWDAGVRYFD        60
     TAPHYGNTKA EHRLGDVLRR YPRGDYVLST KVGRRFVPRT TPFDDREGWQ NPLPFEAIYD       120
     YTHDGILRSF EDSQQRLGIV DIDILLVHDI GRVTHGDNHP HYWRQLTEGG GFRALDGLRS       180
     AGAIKAVGLG VNEGAVILDA MAEFDIDCAL LAGRYTLLEQ STLDDLLPAC ETRGVSILLG       240
     GAFNSGILAR GVEGDLKFNY GEAPREVIER VARLDAVCHA HAVPLAAAAL QFPYAHPAVA       300
     TVLTGARSAD ELRENAASFG QPIPAGLWSA LRDEGLLDSR APVPED                      346
//

If you have problems or comments...

PBIL Back to PBIL home page