(data stored in SCRATCH zone)

EMBL: CP000271.PE69

CP000271.PE69        Location/Qualifiers
FT   CDS             78408..79238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2958"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2958"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33037"
FT                   /db_xref="GOA:Q13SA2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA2"
FT                   /protein_id="ABE33037.1"
FT                   /translation="MHIDAHQHYWDPARGDYEWLTPELKILYRTFGPADLKPLRERAGI
FT                   ERTVVVQAAPTIDETRYLLDIARHEPSIAGVVGWVPLLLPTAPAVIEALAHEPKFKGVR
FT                   PMLQDLPDDTWIANPDLAPAIEALIAHDLAFDALIYARHAEPFETFATRFPALRIVVDH
FT                   GAKPPIRYGRAGYQSWADAITRLAQLPHVHCKLSGLATEASPGWTEATLQPYVDHLLKS
FT                   FGPARLMWGSDWPVLDLNGDYLLWHSVANTLLSSLSDGEREAVFGGNAAAFYRL"
     MHIDAHQHYW DPARGDYEWL TPELKILYRT FGPADLKPLR ERAGIERTVV VQAAPTIDET        60
     RYLLDIARHE PSIAGVVGWV PLLLPTAPAV IEALAHEPKF KGVRPMLQDL PDDTWIANPD       120
     LAPAIEALIA HDLAFDALIY ARHAEPFETF ATRFPALRIV VDHGAKPPIR YGRAGYQSWA       180
     DAITRLAQLP HVHCKLSGLA TEASPGWTEA TLQPYVDHLL KSFGPARLMW GSDWPVLDLN       240
     GDYLLWHSVA NTLLSSLSDG EREAVFGGNA AAFYRL                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page