(data stored in SCRATCH zone)

EMBL: CP000271.PE71

CP000271.PE71        Location/Qualifiers
FT   CDS             80084..80932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2956"
FT                   /product="Fumarylacetoacetate hydrolase family protein"
FT                   /EC_number="4.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2956"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33039"
FT                   /db_xref="GOA:Q13SA0"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:Q13SA0"
FT                   /protein_id="ABE33039.1"
FT                   /translation="MKLLRYGPKGQEKPGLLDAQGKIRDLSKVVADIDGAALTDEGLAR
FT                   LRALDPASLPLVEGNPRIGPCVGKIGKFICIGLNYADHAAESNLPVPAEPVIFNKWTSA
FT                   ISGPNDDVEIPRGSKKTDWEVELGVVIGKPAKYIDEANALDYVAGYCVINDVSEREWQI
FT                   EKGGTWDKGKGFDTFGPIGPWVVTRDEVADPQNLSLWLEVDGHRYQNGSTKTMVFGVAK
FT                   LVSYVSQCMSLQPGDVISTGTPPGVGMGVKPNPVFLKPGQTIRLGIEGLGEQTQKTYAA
FT                   E"
     MKLLRYGPKG QEKPGLLDAQ GKIRDLSKVV ADIDGAALTD EGLARLRALD PASLPLVEGN        60
     PRIGPCVGKI GKFICIGLNY ADHAAESNLP VPAEPVIFNK WTSAISGPND DVEIPRGSKK       120
     TDWEVELGVV IGKPAKYIDE ANALDYVAGY CVINDVSERE WQIEKGGTWD KGKGFDTFGP       180
     IGPWVVTRDE VADPQNLSLW LEVDGHRYQN GSTKTMVFGV AKLVSYVSQC MSLQPGDVIS       240
     TGTPPGVGMG VKPNPVFLKP GQTIRLGIEG LGEQTQKTYA AE                          282
//

If you have problems or comments...

PBIL Back to PBIL home page