(data stored in SCRATCH zone)

EMBL: CP000271.PE74

CP000271.PE74        Location/Qualifiers
FT   CDS             complement(82931..83365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2953"
FT                   /product="Phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2953"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33042"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S97"
FT                   /protein_id="ABE33042.1"
FT                   /translation="MTDLLDRARGALHAQPFSMLLGAELMHTGTNELTLSLPIRDELRQ
FT                   QHGFVHGGVISYLVDNALTFAGALLLGPKVVTGEYKINYLRPAVNGMLIARAKVVYAGQ
FT                   HQATCQCNVFVMEGNREKLIAVAQGTVNRISESGEHEHGN"
     MTDLLDRARG ALHAQPFSML LGAELMHTGT NELTLSLPIR DELRQQHGFV HGGVISYLVD        60
     NALTFAGALL LGPKVVTGEY KINYLRPAVN GMLIARAKVV YAGQHQATCQ CNVFVMEGNR       120
     EKLIAVAQGT VNRISESGEH EHGN                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page