(data stored in ACNUC7421 zone)

EMBL: CP000271.PE77

CP000271.PE77        Location/Qualifiers
FT   CDS             85793..86068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2950"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S94"
FT                   /protein_id="ABE33045.1"
FT                   /translation="MTHYLQEELTSFWSRLTPYLAILESKSPQEGAPDPVGRITVDTVD
FT                   RQAFALHTTDQKPHGDASDIPTGQSATYMRFKSAGSDWSPWQREEY"
     MTHYLQEELT SFWSRLTPYL AILESKSPQE GAPDPVGRIT VDTVDRQAFA LHTTDQKPHG        60
     DASDIPTGQS ATYMRFKSAG SDWSPWQREE Y                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page