(data stored in ACNUC7421 zone)

EMBL: CP000271.PE80

CP000271.PE80        Location/Qualifiers
FT   CDS             88338..89693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_B2947"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_B2947"
FT                   /db_xref="EnsemblGenomes-Tr:ABE33048"
FT                   /db_xref="GOA:Q13S91"
FT                   /db_xref="UniProtKB/TrEMBL:Q13S91"
FT                   /protein_id="ABE33048.1"
FT                   /translation="MADSVASTQSRPSRAASKKRRQATVSTETENKLARAARSAQRLAQ
FT                   LSDASRDDATLDLFPDDPTRATLEAMNIDIRQGTLHGFELPDVVLAAVGAIDTGDSASL
FT                   EARAARRAPRTPKSDEPVPVNAQLSGLEIESVAAMAAMVSPVGELALGDTKPATDANAE
FT                   EKPAVSAPLTPAMAAATVARSVTALRQASEPGAATGVTTDTPVASTSGVGKAPQRFAAT
FT                   FAKAASASASASALRGTHTAETTSAVDEPAPAESDAAPTESKAGTETLAHPSAPAQAST
FT                   EFATPWREARRAEAAAAALRAAPELDRARATAFADTVDALYGVIADQRRAATDHSRRMK
FT                   WMLSIVVGALLVTVAIGITQTVLLIRLTRETTAQQHRIEQMMQNQQAAMTSLLDTHLAM
FT                   AMAMANAVAVNAAPAAATAAPATPQQATATAAHTRRTVRAQHSHRPKAASPH"
     MADSVASTQS RPSRAASKKR RQATVSTETE NKLARAARSA QRLAQLSDAS RDDATLDLFP        60
     DDPTRATLEA MNIDIRQGTL HGFELPDVVL AAVGAIDTGD SASLEARAAR RAPRTPKSDE       120
     PVPVNAQLSG LEIESVAAMA AMVSPVGELA LGDTKPATDA NAEEKPAVSA PLTPAMAAAT       180
     VARSVTALRQ ASEPGAATGV TTDTPVASTS GVGKAPQRFA ATFAKAASAS ASASALRGTH       240
     TAETTSAVDE PAPAESDAAP TESKAGTETL AHPSAPAQAS TEFATPWREA RRAEAAAAAL       300
     RAAPELDRAR ATAFADTVDA LYGVIADQRR AATDHSRRMK WMLSIVVGAL LVTVAIGITQ       360
     TVLLIRLTRE TTAQQHRIEQ MMQNQQAAMT SLLDTHLAMA MAMANAVAVN AAPAAATAAP       420
     ATPQQATATA AHTRRTVRAQ HSHRPKAASP H                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page